caption a7 genomic islands Search Results


96
ATCC caption a7 genomic islands
Caption A7 Genomic Islands, supplied by ATCC, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/caption a7 genomic islands/product/ATCC
Average 96 stars, based on 1 article reviews
caption a7 genomic islands - by Bioz Stars, 2026-04
96/100 stars
  Buy from Supplier

93
Vector Laboratories caption a7 lectin ligand motifs aav binding n acetylglucosamine sialic acid
Lectins used to determine the glycoconjugate profile of adipose-derived stem cells and the corresponding rAAV serotypes that bind to the glycosylation motif
Caption A7 Lectin Ligand Motifs Aav Binding N Acetylglucosamine Sialic Acid, supplied by Vector Laboratories, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/caption a7 lectin ligand motifs aav binding n acetylglucosamine sialic acid/product/Vector Laboratories
Average 93 stars, based on 1 article reviews
caption a7 lectin ligand motifs aav binding n acetylglucosamine sialic acid - by Bioz Stars, 2026-04
93/100 stars
  Buy from Supplier

94
Bio-Rad caption a7 αl gfp β 2 wga tritc αl gfp β 2 rab11 wt
Ratiometric analysis of αL/β 2 enrichment in ruffles
Caption A7 αl Gfp β 2 Wga Tritc αl Gfp β 2 Rab11 Wt, supplied by Bio-Rad, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/caption a7 αl gfp β 2 wga tritc αl gfp β 2 rab11 wt/product/Bio-Rad
Average 94 stars, based on 1 article reviews
caption a7 αl gfp β 2 wga tritc αl gfp β 2 rab11 wt - by Bioz Stars, 2026-04
94/100 stars
  Buy from Supplier

94
ATCC caption a7 a fumigatus a nidulans a oryzae a niger a flavus strain af293 fgsc a4 atcc 42149 cbs 513 88 nrl 3357 genome size mb
Ratiometric analysis of αL/β 2 enrichment in ruffles
Caption A7 A Fumigatus A Nidulans A Oryzae A Niger A Flavus Strain Af293 Fgsc A4 Atcc 42149 Cbs 513 88 Nrl 3357 Genome Size Mb, supplied by ATCC, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/caption a7 a fumigatus a nidulans a oryzae a niger a flavus strain af293 fgsc a4 atcc 42149 cbs 513 88 nrl 3357 genome size mb/product/ATCC
Average 94 stars, based on 1 article reviews
caption a7 a fumigatus a nidulans a oryzae a niger a flavus strain af293 fgsc a4 atcc 42149 cbs 513 88 nrl 3357 genome size mb - by Bioz Stars, 2026-04
94/100 stars
  Buy from Supplier

95
ATCC caption a7 frequency genome bc1 bc2 bc3 ba1 ba2 bt bc rep
Frequency of the Bc-REP and designed primer sequences in five reported genomes of the B. cereus group a
Caption A7 Frequency Genome Bc1 Bc2 Bc3 Ba1 Ba2 Bt Bc Rep, supplied by ATCC, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/caption a7 frequency genome bc1 bc2 bc3 ba1 ba2 bt bc rep/product/ATCC
Average 95 stars, based on 1 article reviews
caption a7 frequency genome bc1 bc2 bc3 ba1 ba2 bt bc rep - by Bioz Stars, 2026-04
95/100 stars
  Buy from Supplier

90
Jackson Laboratory mouse genome informatics
Resources
Mouse Genome Informatics, supplied by Jackson Laboratory, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/mouse genome informatics/product/Jackson Laboratory
Average 90 stars, based on 1 article reviews
mouse genome informatics - by Bioz Stars, 2026-04
90/100 stars
  Buy from Supplier

96
ATCC caption a7 source organism l lactis subsp lactis atcc 11454 dna source genomic dna forward primer † 5 cgatac catatg caaacaagtcataaaaaggtgagg
Macromolecule-production information
Caption A7 Source Organism L Lactis Subsp Lactis Atcc 11454 Dna Source Genomic Dna Forward Primer † 5 Cgatac Catatg Caaacaagtcataaaaaggtgagg, supplied by ATCC, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/caption a7 source organism l lactis subsp lactis atcc 11454 dna source genomic dna forward primer † 5 cgatac catatg caaacaagtcataaaaaggtgagg/product/ATCC
Average 96 stars, based on 1 article reviews
caption a7 source organism l lactis subsp lactis atcc 11454 dna source genomic dna forward primer † 5 cgatac catatg caaacaagtcataaaaaggtgagg - by Bioz Stars, 2026-04
96/100 stars
  Buy from Supplier

90
Thermo Fisher human genome u133 plus 2.0 array
The characteristics of the datasets.
Human Genome U133 Plus 2.0 Array, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/human genome u133 plus 2.0 array/product/Thermo Fisher
Average 90 stars, based on 1 article reviews
human genome u133 plus 2.0 array - by Bioz Stars, 2026-04
90/100 stars
  Buy from Supplier

93
ATCC caption a7 strain atcc lineage
The characteristics of the datasets.
Caption A7 Strain Atcc Lineage, supplied by ATCC, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/caption a7 strain atcc lineage/product/ATCC
Average 93 stars, based on 1 article reviews
caption a7 strain atcc lineage - by Bioz Stars, 2026-04
93/100 stars
  Buy from Supplier

90
BioNano Genomics bionano scaffolds
Statistical data summary of the USDA_OmykA_1.1 (Arlee) rainbow trout genome assembly
Bionano Scaffolds, supplied by BioNano Genomics, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/bionano scaffolds/product/BioNano Genomics
Average 90 stars, based on 1 article reviews
bionano scaffolds - by Bioz Stars, 2026-04
90/100 stars
  Buy from Supplier

90
Phase Genomics sequence contigs
Recent Results of Physical Maps Aligned to Their Respective Reference Genomes
Sequence Contigs, supplied by Phase Genomics, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/sequence contigs/product/Phase Genomics
Average 90 stars, based on 1 article reviews
sequence contigs - by Bioz Stars, 2026-04
90/100 stars
  Buy from Supplier

90
Illumina Inc next generation sanger 454
Characteristics of several commercially available NGS platforms
Next Generation Sanger 454, supplied by Illumina Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/next generation sanger 454/product/Illumina Inc
Average 90 stars, based on 1 article reviews
next generation sanger 454 - by Bioz Stars, 2026-04
90/100 stars
  Buy from Supplier

Image Search Results


Lectins used to determine the glycoconjugate profile of adipose-derived stem cells and the corresponding rAAV serotypes that bind to the glycosylation motif

Journal: Human Gene Therapy Methods

Article Title: Adeno-Associated Virus 5 Transduces Adipose-Derived Stem Cells with Greater Efficacy Than Other Adeno-Associated Viral Serotypes

doi: 10.1089/hgtb.2016.123

Figure Lengend Snippet: Lectins used to determine the glycoconjugate profile of adipose-derived stem cells and the corresponding rAAV serotypes that bind to the glycosylation motif

Article Snippet: The cells were mounted with Vectashield mounting medium with DAPI (Vector Laboratories) and images were taken, using a confocal microscope (Olympus FV1000) with a × 60 oil immersion lens. table ft1 table-wrap mode="anchored" t5 Table 1. caption a7 Lectin Ligand motifs AAV binding N -Acetylglucosamine (sialic acid)-binding lectins Maackia amurensis leukoagglutinin (MAL) from Maackia amurensis Neu5Ac/Gcα2,3Galβ1,4Glc(NAc) AAV1, AAV4, AAV5 Wheat germ agglutinin (WGA) from Triticum vulgaris GlcNAcβ1-4GlcNAcβ1-4GlcNAc, Neu5Ac (sialic acid) AAV4, AAV5 N -Acetylgalactosamine (galactose)-binding lectins Peanut agglutinin (PNA) from Arachis hypogaea Galβ1-3GalNAcα1-Ser/Thr AAV9 Ricinus communis agglutinin (RCA) from Ricinus communis Galβ1-4GalNAcβ1-R AAV9 Soybean agglutinin (SBA) from soybean N -Acetylgalactosamine (GalNAc) residues Mannose-binding lectins Concanavalin A (ConA) from Canavalia ensiformis α- d -Mannosyl and α- d -glucosyl residues AAV9 Fucose-binding lectins Ulex europaeus agglutinin (UEA) from Ulex europaeus Fucα1-2Gal-R Open in a separate window rAAV, recombinant adeno-associated virus.

Techniques: Binding Assay

Ratiometric analysis of αL/β 2 enrichment in ruffles

Journal:

Article Title: Dynamic Partitioning into Lipid Rafts Controls the Endo-Exocytic Cycle of the ?L/? 2 Integrin, LFA-1, during Leukocyte Chemotaxis D⃞

doi: 10.1091/mbc.E05-05-0413

Figure Lengend Snippet: Ratiometric analysis of αL/β 2 enrichment in ruffles

Article Snippet: Cells were then inspected with a laser scanning confocal microscope MRC-1024 (Bio-Rad, Hercules, CA), and the distribution analysis was performed as indicated in legend. table ft1 table-wrap mode="anchored" t5 Table 1. caption a7 αL-GFP/β 2 WGA-TRITC αL-GFP/β 2 + Rab11 wt a 11.7 ± 4.8 b 1.8 ± 0.3 αL-GFP/β 2 + Rab11 S25N 6.4 ± 3.2 1.9 ± 0.7 Open in a separate window a HAfpR-CHO cells were transiently cotransfected with αL-GFP/β 2 and either Rab11 wt or Rab11 S25N constructs.

Techniques:

Confocal microscopy analysis of fMLF-induced endosomal localization of αL/β2 in PMN. Primary PMN were labeled at 4°C with a Fab′ fragment of an anti-αL mAb, followed by fMLF stimulation and incubation for the indicated time points. Cells were then fixed, permeabilized, and stained with a Cy3-conjugated goat anti-mouse immunoglobulin antiserum (left). Endogenous Rab11 was detected with an affinity-purified rabbit antiserum followed by an FITC-conjugated goat anti-rabbit antibody (top and middle center panels). Endogenous LAMP-1 was detected with an anti-LAMP-1 mAb (IgG2b) followed by a FITC-conjugated, isotype-specific antiserum (bottom center). Nuclei were detected with Hoechst 33342 (blue fluorescence). Right, merged images.

Journal:

Article Title: Dynamic Partitioning into Lipid Rafts Controls the Endo-Exocytic Cycle of the ?L/? 2 Integrin, LFA-1, during Leukocyte Chemotaxis D⃞

doi: 10.1091/mbc.E05-05-0413

Figure Lengend Snippet: Confocal microscopy analysis of fMLF-induced endosomal localization of αL/β2 in PMN. Primary PMN were labeled at 4°C with a Fab′ fragment of an anti-αL mAb, followed by fMLF stimulation and incubation for the indicated time points. Cells were then fixed, permeabilized, and stained with a Cy3-conjugated goat anti-mouse immunoglobulin antiserum (left). Endogenous Rab11 was detected with an affinity-purified rabbit antiserum followed by an FITC-conjugated goat anti-rabbit antibody (top and middle center panels). Endogenous LAMP-1 was detected with an anti-LAMP-1 mAb (IgG2b) followed by a FITC-conjugated, isotype-specific antiserum (bottom center). Nuclei were detected with Hoechst 33342 (blue fluorescence). Right, merged images.

Article Snippet: Cells were then inspected with a laser scanning confocal microscope MRC-1024 (Bio-Rad, Hercules, CA), and the distribution analysis was performed as indicated in legend. table ft1 table-wrap mode="anchored" t5 Table 1. caption a7 αL-GFP/β 2 WGA-TRITC αL-GFP/β 2 + Rab11 wt a 11.7 ± 4.8 b 1.8 ± 0.3 αL-GFP/β 2 + Rab11 S25N 6.4 ± 3.2 1.9 ± 0.7 Open in a separate window a HAfpR-CHO cells were transiently cotransfected with αL-GFP/β 2 and either Rab11 wt or Rab11 S25N constructs.

Techniques: Confocal Microscopy, Labeling, Incubation, Staining, Affinity Purification, Fluorescence

αL/β2 is recycled via a Rab11-positive compartment. CHO cells stably expressing the fMLF receptor were transiently transfected with αL/β2-GFP and either a wt or a Rab11S25N mutant, expressed as monomeric DsRed chimeric constructs. Twenty-four hours posttransfection, cells were fixed and inspected by laser scanning confocal microscopy.

Journal:

Article Title: Dynamic Partitioning into Lipid Rafts Controls the Endo-Exocytic Cycle of the ?L/? 2 Integrin, LFA-1, during Leukocyte Chemotaxis D⃞

doi: 10.1091/mbc.E05-05-0413

Figure Lengend Snippet: αL/β2 is recycled via a Rab11-positive compartment. CHO cells stably expressing the fMLF receptor were transiently transfected with αL/β2-GFP and either a wt or a Rab11S25N mutant, expressed as monomeric DsRed chimeric constructs. Twenty-four hours posttransfection, cells were fixed and inspected by laser scanning confocal microscopy.

Article Snippet: Cells were then inspected with a laser scanning confocal microscope MRC-1024 (Bio-Rad, Hercules, CA), and the distribution analysis was performed as indicated in legend. table ft1 table-wrap mode="anchored" t5 Table 1. caption a7 αL-GFP/β 2 WGA-TRITC αL-GFP/β 2 + Rab11 wt a 11.7 ± 4.8 b 1.8 ± 0.3 αL-GFP/β 2 + Rab11 S25N 6.4 ± 3.2 1.9 ± 0.7 Open in a separate window a HAfpR-CHO cells were transiently cotransfected with αL-GFP/β 2 and either Rab11 wt or Rab11 S25N constructs.

Techniques: Stable Transfection, Expressing, Transfection, Mutagenesis, Construct, Confocal Microscopy

Frequency of the Bc-REP and designed primer sequences in five reported genomes of the B. cereus group a

Journal:

Article Title: Fingerprinting of Bacillus thuringiensis Type Strains and Isolates by Using Bacillus cereus Group-Specific Repetitive Extragenic Palindromic Sequence-Based PCR Analysis

doi: 10.1128/AEM.71.3.1346-1355.2005

Figure Lengend Snippet: Frequency of the Bc-REP and designed primer sequences in five reported genomes of the B. cereus group a

Article Snippet: No further significant matches were found in all the genomes and nucleotide sequences available at the EMBL and NCBI gene banks, including the poorly sequenced B. mycoides (see below). table ft1 table-wrap mode="anchored" t5 TABLE 3. caption a7 Frequency Genome Bc1 Bc2 Bc3 Ba1 Ba2 Bt Bc-REP 100% 28 58 15 14 14 15 Bc-REP 96% 24 18 6 6 6 8 Direct 89 94 32 28 28 33 Reverse 37 71 20 18 18 19 Open in a separate window a Bc1, B. cereus ATCC 14579 genome (NC 004722.1); Bc2, B. cereus ATCC 10987 genome (NC 003909.8); Bc3, B. cereus ZK genome (NC 006274); Ba1, B. anthracis strain Ames genome (NC 003997.3); Ba2, B. anthracis strain Sterne genome (NC 005945.1); Bt, B. thuringiensis strain 97.27 genome (NC 005957.1); Bc-REP 100%, frequency of sequences showing 100% homology with Bc-REP; Bc-REP 96%, frequency of sequences showing 96% homology with Bc-REP; Direct, frequency of sequences showing 100% homology with the designed direct primer; Reverse, frequency of sequences showing 100% homology with the designed reverse primer.

Techniques:

Resources

Journal: Applied nursing research : ANR

Article Title: Animal Models in Genomic Research: Techniques, Applications, and Roles for Nurses

doi: 10.1016/j.apnr.2016.07.016

Figure Lengend Snippet: Resources

Article Snippet: Resources for appropriate selection of a model, strain, and substrain are described later ( ). table ft1 table-wrap mode="anchored" t5 caption a7 Resource Name Sponsor/Source Description URL Mouse Genome Informatics The Jackson Laboratory with data contributed form several well-known research groups International database providing a wealth of data (e.g. genetic, genomic, biological, phenotypic) about laboratory mice used in biomedical research.

Techniques: Sequencing, Variant Assay, Knock-Out, Functional Assay, Produced, Generated, Mutagenesis

Macromolecule-production information

Journal: Acta Crystallographica. Section F, Structural Biology Communications

Article Title: Full-length nisin immunity protein NisI from Lactococcus lactis in a lipid-free form: crystallization and X-ray analysis

doi: 10.1107/S2053230X17008214

Figure Lengend Snippet: Macromolecule-production information

Article Snippet: To quench the methylation reaction, 1 M Tris–HCl pH 8.0 was added to give a concentration of 100 m M . Finally, the sample was further purified using a Superdex 200 pg 26/600 column (GE Healthcare) equilibrated with 10 m M Tris–HCl pH 8.0, 50 m M NaCl, 2 m M β-mercaptoethanol. table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 Source organism L. lactis subsp. lactis ATCC 11454 DNA source Genomic DNA Forward primer † 5′-CGATAC CATATG CAAACAAGTCATAAAAAGGTGAGG-3′ Reverse primer † 5′-G GAATTC ACTCGAGGTTTCCTACCTTCGTTGCAAGC-3′ Cloning vector pSKB3 (modified pET-28a) Expression vector pSKB3 (modified pET-28a) Expression host E. coli BL21 (DE3) Star Complete amino-acid sequence of the construct produced ‡ MGSSHHHHHHDYDIPTTENLYFQGHM QTSHKKVRFDEGSYTNFIYDNKSYFVTDKEIPQENVNNSKVKFYKLLIVDMKSEKLLSSSNKNSVTLVLNNIYEASDKSLCMGINDRYYKILPESDKGAVKALRLQNFDVTSDISDDNFVIDKNDSRKIDYMGNIYSISDTTVSDEELGEYQDVLAEVRVFDSVSGKSIPRSEWGRIDKDGSNSKQSRTEWDYGEIHSIRGKSLTEAFAVEINDDFKLATKVGN LE Open in a separate window † Restriction sites are underlined.

Techniques: Cloning, Plasmid Preparation, Modification, Expressing, Sequencing, Construct, Produced

The characteristics of the datasets.

Journal: Turkish Journal of Biology

Article Title: hsa-miR-301a- and SOX10-dependent miRNA-TF-mRNA regulatory circuits in breast cancer

doi: 10.3906/biy-1708-17

Figure Lengend Snippet: The characteristics of the datasets.

Article Snippet: As a result, 2 independent mRNA studies and 1 miRNA study including breast tumors and normal samples were selected to be analyzed (Table ). table ft1 table-wrap mode="anchored" t5 Table 1 caption a7 GEO ID Platform Normal samples Tumor samples GSE3744 Affymetrix Human Genome U133 Plus 2.0 Array 7 40 GSE5764 Affymetrix Human Genome U133 Plus 2.0 Array 15 15 GSE45666 Agilent-021827 Human miRNA Microarray G4470C 15 80 GSE17907 (Test data) Affymetrix Human Genome U133 Plus 2.0 Array 4 51 Open in a separate window The characteristics of the datasets.

Techniques: Microarray

Statistical data summary of the USDA_OmykA_1.1 (Arlee) rainbow trout genome assembly

Journal: G3: Genes|Genomes|Genetics

Article Title: A long reads-based de-novo assembly of the genome of the Arlee homozygous line reveals chromosomal rearrangements in rainbow trout

doi: 10.1093/g3journal/jkab052

Figure Lengend Snippet: Statistical data summary of the USDA_OmykA_1.1 (Arlee) rainbow trout genome assembly

Article Snippet: The total length of the 710 unplaced scaffolds that are not anchored to a chromosome is ∼108 Mb. table ft1 table-wrap mode="anchored" t5 caption a7 Feature Canu contigs Polished contigs BioNano scaffolds Hi-C scaffolds With linkage information Number of sequences 1,591 1,591 1,044 919 938 Total length 2,340,653,759 2,341,478,269 2,341,947,072 2,342,042,072 2,341,652,372 Maximum length 63,126,076 63,163,333 88,429,459 90,526,592 88,429,459 Minimum length 1,061 1,057 16,956 16,956 16,956 N50 9,835,815 9,837,718 28,011,862 47,542,702 39,165,350 L50 58 58 31 17 22 N90 1,125,404 1,125,715 1,804,217 2,489,804 2,487,114 L90 333 333 170 98 116 BUSCO * C: 95.9% (S: 48.3%; D: 47.6%) C: 96.2% (S: 46.2%; D: 50.0%) NA C: 96.4% (S: 46.7%; D: 49.7%) NA Open in a separate window * Benchmarking Universal Single-Copy Orthologs.

Techniques:

Recent Results of Physical Maps Aligned to Their Respective Reference Genomes

Journal: The Plant Cell

Article Title: Is It Ordered Correctly? Validating Genome Assemblies by Optical Mapping [OPEN]

doi: 10.1105/tpc.17.00514

Figure Lengend Snippet: Recent Results of Physical Maps Aligned to Their Respective Reference Genomes

Article Snippet: Some genomic regions are easily corrected, others require multiple iterations to untangle and resolve discrepancies , and others will likely remain unresolved and may require local reassembly of the underlying DNA sequence. fig ft0 fig mode=article f1 fig/graphic|fig/alternatives/graphic mode="anchored" m1 Open in a separate window Figure 3. caption a7 Sequence Contigs from G. herbaceum Chromosome 4 Ordered and Oriented into Pseudomolecules by the Hi-C Methodology (as Assembled by PhaseGenomics). (A) The first row is a colored bar that represents the concatenated contigs based on clustering and orientation likelihood ratios of Hi-C data.

Techniques: Sequencing

An Illustration of Bionano Contigs Likely Spanning Centromeric Regions in the G. herbaceum Reference.

Journal: The Plant Cell

Article Title: Is It Ordered Correctly? Validating Genome Assemblies by Optical Mapping [OPEN]

doi: 10.1105/tpc.17.00514

Figure Lengend Snippet: An Illustration of Bionano Contigs Likely Spanning Centromeric Regions in the G. herbaceum Reference.

Article Snippet: Some genomic regions are easily corrected, others require multiple iterations to untangle and resolve discrepancies , and others will likely remain unresolved and may require local reassembly of the underlying DNA sequence. fig ft0 fig mode=article f1 fig/graphic|fig/alternatives/graphic mode="anchored" m1 Open in a separate window Figure 3. caption a7 Sequence Contigs from G. herbaceum Chromosome 4 Ordered and Oriented into Pseudomolecules by the Hi-C Methodology (as Assembled by PhaseGenomics). (A) The first row is a colored bar that represents the concatenated contigs based on clustering and orientation likelihood ratios of Hi-C data.

Techniques:

Sequence Contigs from G. herbaceum Chromosome 4 Ordered and Oriented into Pseudomolecules by the Hi-C Methodology (as Assembled by PhaseGenomics).

Journal: The Plant Cell

Article Title: Is It Ordered Correctly? Validating Genome Assemblies by Optical Mapping [OPEN]

doi: 10.1105/tpc.17.00514

Figure Lengend Snippet: Sequence Contigs from G. herbaceum Chromosome 4 Ordered and Oriented into Pseudomolecules by the Hi-C Methodology (as Assembled by PhaseGenomics).

Article Snippet: Some genomic regions are easily corrected, others require multiple iterations to untangle and resolve discrepancies , and others will likely remain unresolved and may require local reassembly of the underlying DNA sequence. fig ft0 fig mode=article f1 fig/graphic|fig/alternatives/graphic mode="anchored" m1 Open in a separate window Figure 3. caption a7 Sequence Contigs from G. herbaceum Chromosome 4 Ordered and Oriented into Pseudomolecules by the Hi-C Methodology (as Assembled by PhaseGenomics). (A) The first row is a colored bar that represents the concatenated contigs based on clustering and orientation likelihood ratios of Hi-C data.

Techniques: Sequencing, Hi-C

Characteristics of several commercially available NGS platforms

Journal: Heredity

Article Title: From next-generation resequencing reads to a high-quality variant data set

doi: 10.1038/hdy.2016.102

Figure Lengend Snippet: Characteristics of several commercially available NGS platforms

Article Snippet: Thereby, the large amount of data with shorter read lengths, higher per-base error rates and nonuniform coverage, together with platform-specific read error profiles and artifacts , imposes several statistical and computational challenges in the reliable detection of variants from NGS data ( Harismendy et al. , 2009 ). table ft1 table-wrap mode="anchored" t5 caption a7 Capillary Next generation Sanger 454 Illumina Ion Torrent Platform 3730xl GS FLX+ GS Jr. a HiSeq X Ten HiSeq 2500 MiSeq a PGM 318 a Template preparation Plasmid/PCR emPCR emPCR Solid phase Solid phase Solid phase emPCR Run time ~3 h ~1 Day ~10 h ~3 Days ~6 Days ~65 h ~4–7 h Output/run 0.08 Mb 700 Mb 35 Mb 1.8 Tb 1 Tb 15 Gb 2 Gb Read length 1 kb 1 kb 700 b 2 × 150 b 2 × 125 b 2 × 300 b 400 b No. of reads/run 96 (standard) up to 384 (rare) 1 M 0.1 M 6 B 4 B 25 M 5.5 M Error rate b 0.1–1% ~1% ~1% ~0.1% ~0.1% ~0.1% ~1% Primary errors Substitutions Indels Substitutions c Indels Advantages • Long reads • High quality • Long reads • Fast run time • Highest throughput • Low per-base cost • Unmodified nucleotides • No optical scanning necessary, and thus no photo damage • Fast run time Limitations • Low throughput • High costs • High error rates in homopolymer regions • Low throughput • High costs • Cumbersome emPCR • Short reads • Random dispersion of clusters can cause poor sequence quality • Underrepresentation of AT-rich and GC-rich regions • High error rates in homopolymer regions • Cumbersome emPCR Open in a separate window Abbreviations: emPCR, emulsion PCR; NGS, next-generation sequencing.

Techniques: Plasmid Preparation, Sequencing